Lineage for d1h91b_ (1h91 B:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 113440Fold b.60: Lipocalins [50813] (1 superfamily)
  4. 113441Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
  5. 113442Family b.60.1.1: Retinol binding protein-like [50815] (14 proteins)
  6. 113443Protein Alpha-crustacyanin [63807] (1 species)
  7. 113444Species European lobster (Homarus gammarus) [TaxId:6707] [63808] (2 PDB entries)
  8. 113448Domain d1h91b_: 1h91 B: [60806]

Details for d1h91b_

PDB Entry: 1h91 (more details), 1.4 Å

PDB Description: the crystal structure of lobster apocrustacyanin a1 using softer x- rays.

SCOP Domain Sequences for d1h91b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h91b_ b.60.1.1 (B:) Alpha-crustacyanin {European lobster (Homarus gammarus)}
kipnfvvpgkcasvdrnklwaeqtpnrnsyagvwyqfaltnnpyqliekcvrneysfdgk
qfvikstgiaydgnllkrngklypnpfgephlsidyensfaaplviletdysnyaclysc
idynfgyhsdfsfifsrsanladqyvkkceaafkninvdttrfvktvqgsscpydtqktv

SCOP Domain Coordinates for d1h91b_:

Click to download the PDB-style file with coordinates for d1h91b_.
(The format of our PDB-style files is described here.)

Timeline for d1h91b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1h91a_