SCOPe 2.06: Domain d1h69b_: 1h69 B:

Lineage for d1h69b_ (1h69 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.3: Quinone reductase [52235] (4 proteins)
   binds FAD

6. Protein NAD(P)H:quinone reductase [52236] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52239] (8 PDB entries)

8. Domain d1h69b_: 1h69 B: [60666]
   complexed with arh, fad

Details for d1h69b_

PDB Entry: 1h69, 1.86 Å

PDB Description: crystal structure of human nad[p]h-quinone oxidoreductase co with 2,3,5,6,tetramethyl-p-benzoquinone (duroquinone) at 2.5 angstrom resolution

PDB Compounds: (B:) nad(p)h dehydrogenase [quinone] 1

SCOPe Domain Sequences for d1h69b_:

Sequence; same for both SEQRES and ATOM records:

>d1h69b_ c.23.5.3 (B:) NAD(P)H:quinone reductase {Human (Homo sapiens) [TaxId: 9606]}
agrralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklk
dpanfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervf
igefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcg
fqvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkk
evqdeeknkkfglsvghhlgksiptdnqikark

Timeline for d1h69b_:

• d1h69b_ first appeared in SCOP 1.57
  
• d1h69b_ appears in SCOPe 2.05
  
• d1h69b_ appears in SCOPe 2.07
  
• d1h69b_ appears in the current release, SCOPe 2.08