PDB entry 1h69

View 1h69 on RCSB PDB site
Description: crystal structure of human nad[p]h-quinone oxidoreductase co with 2,3,5,6,tetramethyl-p-benzoquinone (duroquinone) at 2.5 angstrom resolution
Class: oxidoreductase
Keywords: flavoprotein, rossmann fold, oxidoreductase
Deposited on 2001-06-08, released 2001-09-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.229
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nad(p)h dehydrogenase [quinone] 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15559 (0-272)
      • conflict (0)
    Domains in SCOPe 2.06: d1h69a_
  • Chain 'B':
    Compound: nad(p)h dehydrogenase [quinone] 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15559 (0-272)
      • conflict (0)
    Domains in SCOPe 2.06: d1h69b_
  • Chain 'C':
    Compound: nad(p)h dehydrogenase [quinone] 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15559 (0-272)
      • conflict (0)
    Domains in SCOPe 2.06: d1h69c_
  • Chain 'D':
    Compound: nad(p)h dehydrogenase [quinone] 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15559 (0-272)
      • conflict (0)
    Domains in SCOPe 2.06: d1h69d_
  • Heterogens: FAD, ARH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h69A (A:)
    agrralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklk
    dpanfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervf
    igefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcg
    fqvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkk
    evqdeeknkkfglsvghhlgksiptdnqikark
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h69B (B:)
    agrralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklk
    dpanfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervf
    igefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcg
    fqvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkk
    evqdeeknkkfglsvghhlgksiptdnqikark
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h69C (C:)
    agrralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklk
    dpanfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervf
    igefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcg
    fqvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkk
    evqdeeknkkfglsvghhlgksiptdnqikark
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1h69D (D:)
    agrralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklk
    dpanfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervf
    igefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcg
    fqvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkk
    evqdeeknkkfglsvghhlgksiptdnqikark