Lineage for d1h69b_ (1h69 B:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.23: Flavodoxin-like [52171] (17 superfamilies) 
Superfamily c.23.5: Flavoproteins [52218] (3 families) 
Family c.23.5.3: Quinone reductase [52235] (2 proteins) Protein NAD(P)H:quinone reductase [52236] (3 species) Species Human (Homo sapiens) [TaxId:9606] [52239] (6 PDB entries) 
Domain d1h69b_: 1h69 B: [60666]
Details for d1h69b_
PDB Entry: 1h69 (more details), 1.86 Å
PDB Description: crystal structure of human nad[p]h-quinone oxidoreductase co with 2,3,5,6,tetramethyl-p-benzoquinone (duroquinone) at 2.5 angstrom resolution
SCOP Domain Sequences for d1h69b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h69b_ c.23.5.3 (B:) NAD(P)H:quinone reductase {Human (Homo sapiens)}
agrralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklk
dpanfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervf
igefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcg
fqvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkk
evqdeeknkkfglsvghhlgksiptdnqikark
SCOP Domain Coordinates for d1h69b_:
Click to download the PDB-style file with coordinates for d1h69b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h69b_:
- d1h69b_ is new in SCOP 1.57
- d1h69b_ appears in SCOP 1.59
- d1h69b_ appears in the current release, SCOPe 2.08
View in 3D
