SCOPe 2.08: Domain d1gcqa1: 1gcq A:159-213

Lineage for d1gcqa1 (1gcq A:159-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50071] (6 PDB entries)

8. Domain d1gcqa1: 1gcq A:159-213 [60434]
   Other proteins in same PDB: d1gcqa2, d1gcqc1, d1gcqc2
   C-terminal domain
   complexed with mrd

Details for d1gcqa1

PDB Entry: 1gcq, 1.68 Å

PDB Description: crystal structure of vav and grb2 sh3 domains

PDB Compounds: (A:) Growth factor receptor-bound protein 2

SCOPe Domain Sequences for d1gcqa1:

Sequence; same for both SEQRES and ATOM records:

>d1gcqa1 b.34.2.1 (A:159-213) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
tyvqalfdfdpqedgelgfrrgdfihvmdnsdpnwwkgachgqtgmfprnyvtpv

Timeline for d1gcqa1:

• d1gcqa1 first appeared in SCOP 1.57, called d1gcqa_
  
• d1gcqa1 appears in SCOPe 2.07