SCOP 1.57: Domain d1gcqa_: 1gcq A:

Lineage for d1gcqa_ (1gcq A:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.34: SH3-like barrel [50036] (9 superfamilies)

4. Superfamily b.34.2: SH3-domain [50044] (1 family)

5. Family b.34.2.1: SH3-domain [50045] (18 proteins)

6. Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50071] (6 PDB entries)

8. Domain d1gcqa_: 1gcq A: [60434]
   Other proteins in same PDB: d1gcqc_

Details for d1gcqa_

PDB Entry: 1gcq, 1.68 Å

PDB Description: crystal structure of vav and grb2 sh3 domains

SCOP Domain Sequences for d1gcqa_:

Sequence; same for both SEQRES and ATOM records:

>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens)}
styvqalfdfdpqedgelgfrrgdfihvmdnsdpnwwkgachgqtgmfprnyvtpv

Timeline for d1gcqa_:

• d1gcqa_ is new in SCOP 1.57
  
• d1gcqa_ appears in SCOP 1.59
  
• d1gcqa_ appears in the current release, SCOPe 2.08, called d1gcqa1