SCOPe 2.08: Domain d1gcqc1: 1gcq C:595-659

Lineage for d1gcqc1 (1gcq C:595-659)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein Vav N-terminal SH3 domain [63744] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [63745] (3 PDB entries)

8. Domain d1gcqc1: 1gcq C:595-659 [60436]
   Other proteins in same PDB: d1gcqa1, d1gcqa2, d1gcqb_, d1gcqc2
   complexed to Grb2 SH3 domains
   complexed with mrd

Details for d1gcqc1

PDB Entry: 1gcq, 1.68 Å

PDB Description: crystal structure of vav and grb2 sh3 domains

PDB Compounds: (C:) vav proto-oncogene

SCOPe Domain Sequences for d1gcqc1:

Sequence; same for both SEQRES and ATOM records:

>d1gcqc1 b.34.2.1 (C:595-659) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]}
pkmevfqeyygippppgafgpflrlnpgdiveltkaeaehnwwegrntatnevgwfpcnr
vhpyv

Timeline for d1gcqc1:

• d1gcqc1 first appeared in SCOP 1.57, called d1gcqc_
  
• d1gcqc1 appears in SCOPe 2.07