Lineage for d1g8ga1 (1g8g A:2-168)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 232326Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 232327Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 232418Family b.58.1.2: ATP sulfurylase N-terminal domain [63801] (1 protein)
    incomplete barrel of 6 strands, the last PK strand is missing
  6. 232419Protein ATP sulfurylase N-terminal domain [63802] (3 species)
  7. 232420Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63803] (6 PDB entries)
  8. 232423Domain d1g8ga1: 1g8g A:2-168 [60351]
    Other proteins in same PDB: d1g8ga2, d1g8ga3, d1g8gb2, d1g8gb3

Details for d1g8ga1

PDB Entry: 1g8g (more details), 2.6 Å

PDB Description: atp sulfurylase from s. cerevisiae: the binary product complex with aps

SCOP Domain Sequences for d1g8ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8ga1 b.58.1.2 (A:2-168) ATP sulfurylase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
paphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgfln
endyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqdvy
kpnktieaervfrgdpehpaisylfnvagdyyvggsleaiqlpqhyd

SCOP Domain Coordinates for d1g8ga1:

Click to download the PDB-style file with coordinates for d1g8ga1.
(The format of our PDB-style files is described here.)

Timeline for d1g8ga1: