Lineage for d1g8ga1 (1g8g A:2-168)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2823864Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2823865Superfamily b.122.1: PUA domain-like [88697] (15 families) (S)
  5. 2823936Family b.122.1.3: ATP sulfurylase N-terminal domain [63801] (1 protein)
    contains extra structures; some similarity to the PK beta-barrel domain
    automatically mapped to Pfam PF14306
  6. 2823937Protein ATP sulfurylase N-terminal domain [63802] (5 species)
  7. 2823938Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63803] (8 PDB entries)
  8. 2823944Domain d1g8ga1: 1g8g A:2-168 [60351]
    Other proteins in same PDB: d1g8ga2, d1g8ga3, d1g8gb2, d1g8gb3
    complexed with acy, adx, ca, cd, mg, na, trs

Details for d1g8ga1

PDB Entry: 1g8g (more details), 2.6 Å

PDB Description: atp sulfurylase from s. cerevisiae: the binary product complex with aps
PDB Compounds: (A:) sulfate adenylyltransferase

SCOPe Domain Sequences for d1g8ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8ga1 b.122.1.3 (A:2-168) ATP sulfurylase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
paphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgfln
endyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqdvy
kpnktieaervfrgdpehpaisylfnvagdyyvggsleaiqlpqhyd

SCOPe Domain Coordinates for d1g8ga1:

Click to download the PDB-style file with coordinates for d1g8ga1.
(The format of our PDB-style files is described here.)

Timeline for d1g8ga1: