SCOPe 2.08: Domain d1g8ga3: 1g8g A:390-511

Lineage for d1g8ga3 (1g8g A:390-511)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.15: ATP sulfurylase C-terminal domain [64011] (1 protein)

6. Protein ATP sulfurylase C-terminal domain [64012] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64013] (7 PDB entries)

8. Domain d1g8ga3: 1g8g A:390-511 [60353]
   Other proteins in same PDB: d1g8ga1, d1g8ga2, d1g8gb1, d1g8gb2
   complexed with acy, adx, ca, cd, mg, na, trs

Details for d1g8ga3

PDB Entry: 1g8g, 2.6 Å

PDB Description: atp sulfurylase from s. cerevisiae: the binary product complex with aps

PDB Compounds: (A:) sulfate adenylyltransferase

SCOPe Domain Sequences for d1g8ga3:

Sequence; same for both SEQRES and ATOM records:

>d1g8ga3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
prpkqgfsivlgnsltvsreqlsiallstflqfgggryykifehnnktellsliqdfigs
gsgliipdqweddkdsvvgkqnvylldtsssadiqlesadepishivqkvvlfledngff
vf

Timeline for d1g8ga3:

• d1g8ga3 first appeared in SCOP 1.57
  
• d1g8ga3 appears in SCOPe 2.07