SCOPe 2.07: Domain d1g7oa1: 1g7o A:76-215

Lineage for d1g7oa1 (1g7o A:76-215)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Glutaredoxin 2 [63557] (1 species)
   similar to class zeta enzymes

7. Species Escherichia coli [TaxId:562] [63558] (1 PDB entry)

8. Domain d1g7oa1: 1g7o A:76-215 [60332]
   Other proteins in same PDB: d1g7oa2

Details for d1g7oa1

PDB Entry: 1g7o

PDB Description: nmr solution structure of reduced e. coli glutaredoxin 2

PDB Compounds: (A:) glutaredoxin 2

SCOPe Domain Sequences for d1g7oa1:

Sequence; same for both SEQRES and ATOM records:

>d1g7oa1 a.45.1.1 (A:76-215) Glutaredoxin 2 {Escherichia coli [TaxId: 562]}
plltgkrspaieewlrkvngyanklllprfaksafdefstpaarkyfvdkkeasagnfad
llahsdgliknisddlraldklivkpnavngelseddiqlfpllrnltlvaginwpsrva
dyrdnmakqtqinllssmai

Timeline for d1g7oa1:

• d1g7oa1 first appeared in SCOP 1.57
  
• d1g7oa1 appears in SCOPe 2.06
  
• d1g7oa1 appears in the current release, SCOPe 2.08