PDB entry 1g7o

View 1g7o on RCSB PDB site
Description: nmr solution structure of reduced e. coli glutaredoxin 2
Class: oxidoreductase
Keywords: NMR, reduced form of glutaredoxin, OXIDOREDUCTASE
Deposited on 2000-11-10, released 2001-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutaredoxin 2
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g7oa1, d1g7oa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g7oA (A:)
    mklyiydhcpyclkarmifglknipvelhvllnddaetptrmvgqkqvpilqkddsrymp
    esmdivhyvdkldgkplltgkrspaieewlrkvngyanklllprfaksafdefstpaark
    yfvdkkeasagnfadllahsdgliknisddlraldklivkpnavngelseddiqlfpllr
    nltlvaginwpsrvadyrdnmakqtqinllssmai