Lineage for d1g7oa1 (1g7o A:76-215)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 48057Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 48058Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 48059Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (3 proteins)
  6. 48060Protein Glutaredoxin 2 [63557] (1 species)
  7. 48061Species Escherichia coli [TaxId:562] [63558] (1 PDB entry)
  8. 48062Domain d1g7oa1: 1g7o A:76-215 [60332]
    Other proteins in same PDB: d1g7oa2

Details for d1g7oa1

PDB Entry: 1g7o (more details)

PDB Description: nmr solution structure of reduced e. coli glutaredoxin 2

SCOP Domain Sequences for d1g7oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g7oa1 a.45.1.1 (A:76-215) Glutaredoxin 2 {Escherichia coli}
plltgkrspaieewlrkvngyanklllprfaksafdefstpaarkyfvdkkeasagnfad
llahsdgliknisddlraldklivkpnavngelseddiqlfpllrnltlvaginwpsrva
dyrdnmakqtqinllssmai

SCOP Domain Coordinates for d1g7oa1:

Click to download the PDB-style file with coordinates for d1g7oa1.
(The format of our PDB-style files is described here.)

Timeline for d1g7oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g7oa2