Lineage for d1g0nb_ (1g0n B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090553Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2090568Protein 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) [51798] (1 species)
  7. 2090569Species Fungus (Magnaporthe grisea) [TaxId:148305] [51799] (4 PDB entries)
  8. 2090575Domain d1g0nb_: 1g0n B: [60180]
    complexed with ndp, phh

Details for d1g0nb_

PDB Entry: 1g0n (more details), 2 Å

PDB Description: structure of trihydroxynaphthalene reductase in complex with nadph and 4,5,6,7-tetrachloro-phthalide
PDB Compounds: (B:) trihydroxynaphthalene reductase

SCOPe Domain Sequences for d1g0nb_:

Sequence, based on SEQRES records: (download)

>d1g0nb_ c.2.1.2 (B:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Fungus (Magnaporthe grisea) [TaxId: 148305]}
ydaipgplgpqsaslegkvalvtgagrgigremamelgrrgckvivnyanstesaeevva
aikkngsdaacvkanvgvvedivrmfeeavkifgkldivcsnsgvvsfghvkdvtpeefd
rvftintrgqffvareaykhleiggrlilmgsitgqakavpkhavysgskgaietfarcm
aidmadkkitvnvvapggiktdmyhavcreyipngenlsneevdeyaavqwsplrrvglp
idiarvvcflasndggwvtgkvigidggacm

Sequence, based on observed residues (ATOM records): (download)

>d1g0nb_ c.2.1.2 (B:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Fungus (Magnaporthe grisea) [TaxId: 148305]}
ydaipgplgpqsaslegkvalvtgagrgigremamelgrrgckvivnyanstesaeevva
aikkngsdaacvkanvgvvedivrmfeeavkifgkldivcsnsgvvsfghvkdvtpeefd
rvftintrgqffvareaykhleiggrlilmgsitgqakavpkhavysgskgaietfarcm
aidmadkkitvnvvapggiktdmyhadeyaavqwsplrrvglpidiarvvcflasndggw
vtgkvigidggacm

SCOPe Domain Coordinates for d1g0nb_:

Click to download the PDB-style file with coordinates for d1g0nb_.
(The format of our PDB-style files is described here.)

Timeline for d1g0nb_: