PDB entry 1g0n

View 1g0n on RCSB PDB site
Description: structure of trihydroxynaphthalene reductase in complex with nadph and 4,5,6,7-tetrachloro-phthalide
Class: oxidoreductase
Keywords: Protein-NADPH-active site inhibitor complex, diuncleotide binding fold, oxidoreductase, short chain dehydrogenase
Deposited on 2000-10-06, released 2001-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.195
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trihydroxynaphthalene reductase
    Species: Magnaporthe grisea [TaxId:148305]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12634 (Start-282)
      • engineered (240-241)
      • engineered (246)
    Domains in SCOPe 2.07: d1g0na_
  • Chain 'B':
    Compound: trihydroxynaphthalene reductase
    Species: Magnaporthe grisea [TaxId:148305]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12634 (Start-282)
      • engineered (240-241)
      • engineered (246)
    Domains in SCOPe 2.07: d1g0nb_
  • Heterogens: NDP, PHH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g0nA (A:)
    mpavtqprgeskydaipgplgpqsaslegkvalvtgagrgigremamelgrrgckvivny
    anstesaeevvaaikkngsdaacvkanvgvvedivrmfeeavkifgkldivcsnsgvvsf
    ghvkdvtpeefdrvftintrgqffvareaykhleiggrlilmgsitgqakavpkhavysg
    skgaietfarcmaidmadkkitvnvvapggiktdmyhavcreyipngenlsneevdeyaa
    vqwsplrrvglpidiarvvcflasndggwvtgkvigidggacm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g0nA (A:)
    skydaipgplgpqsaslegkvalvtgagrgigremamelgrrgckvivnyanstesaeev
    vaaikkngsdaacvkanvgvvedivrmfeeavkifgkldivcsnsgvvsfghvkdvtpee
    fdrvftintrgqffvareaykhleiggrlilmgsitgqakavpkhavysgskgaietfar
    cmaidmadkkitvnvvapggiktdmyhavcreyipngenlsneevdeyaavqwsplrrvg
    lpidiarvvcflasndggwvtgkvigidggacm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g0nB (B:)
    mpavtqprgeskydaipgplgpqsaslegkvalvtgagrgigremamelgrrgckvivny
    anstesaeevvaaikkngsdaacvkanvgvvedivrmfeeavkifgkldivcsnsgvvsf
    ghvkdvtpeefdrvftintrgqffvareaykhleiggrlilmgsitgqakavpkhavysg
    skgaietfarcmaidmadkkitvnvvapggiktdmyhavcreyipngenlsneevdeyaa
    vqwsplrrvglpidiarvvcflasndggwvtgkvigidggacm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g0nB (B:)
    ydaipgplgpqsaslegkvalvtgagrgigremamelgrrgckvivnyanstesaeevva
    aikkngsdaacvkanvgvvedivrmfeeavkifgkldivcsnsgvvsfghvkdvtpeefd
    rvftintrgqffvareaykhleiggrlilmgsitgqakavpkhavysgskgaietfarcm
    aidmadkkitvnvvapggiktdmyhadeyaavqwsplrrvglpidiarvvcflasndggw
    vtgkvigidggacm