Lineage for d1fyda_ (1fyd A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) Superfamily c.26.2: Adenine nucleotide alpha hydrolases [52402] (2 families) 
Family c.26.2.1: N-type ATP pyrophosphatases [52403] (5 proteins) 
Protein NH3-dependent NAD+-synthetase [52406] (1 species) Species Bacillus subtilis [TaxId:1423] [52407] (6 PDB entries) 
Domain d1fyda_: 1fyd A: [60113]
Details for d1fyda_
PDB Entry: 1fyd (more details), 2.25 Å
PDB Description: crystal structure of nh3-dependent nad+ synthetase from bacillus subtilis complexed with one molecule amp, one pyrophosphate ion and one mg2+ ion
SCOP Domain Sequences for d1fyda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fyda_ c.26.2.1 (A:) NH3-dependent NAD+-synthetase {Bacillus subtilis}
smqekimrelhvkpsidpkqeiedrvnflkqyvkktgakgfvlgisggqdstlagrlaql
avesireeggdaqfiavrlphgtqqdeddaqlalkfikpdkswkfdikstvsafsdqyqq
etgdqltdfnkgnvkartrmiaqyaiggqegllvlgtdhaaeavtgfftkygdggadllp
ltgltkrqgrtllkelgaperlylkeptadlldekpqqsdetelgisydeiddylegkev
sakvsealekrysmtehkrqvpasmfddwwk
SCOP Domain Coordinates for d1fyda_:
Click to download the PDB-style file with coordinates for d1fyda_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fyda_:
- d1fyda_ first appeared in SCOP 1.57
- d1fyda_ appears in SCOP 1.61
- d1fyda_ appears in the current release, SCOPe 2.08
View in 3D
