Lineage for d1fyda_ (1fyd A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2861263Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2861264Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)
  6. 2861350Protein NH3-dependent NAD+-synthetase [52406] (4 species)
  7. 2861360Species Bacillus subtilis [TaxId:1423] [52407] (7 PDB entries)
  8. 2861373Domain d1fyda_: 1fyd A: [60113]
    complexed with amp, mg, pop
    has additional insertions and/or extensions that are not grouped together

Details for d1fyda_

PDB Entry: 1fyd (more details), 2.25 Å

PDB Description: crystal structure of nh3-dependent nad+ synthetase from bacillus subtilis complexed with one molecule amp, one pyrophosphate ion and one mg2+ ion
PDB Compounds: (A:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d1fyda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fyda_ c.26.2.1 (A:) NH3-dependent NAD+-synthetase {Bacillus subtilis [TaxId: 1423]}
smqekimrelhvkpsidpkqeiedrvnflkqyvkktgakgfvlgisggqdstlagrlaql
avesireeggdaqfiavrlphgtqqdeddaqlalkfikpdkswkfdikstvsafsdqyqq
etgdqltdfnkgnvkartrmiaqyaiggqegllvlgtdhaaeavtgfftkygdggadllp
ltgltkrqgrtllkelgaperlylkeptadlldekpqqsdetelgisydeiddylegkev
sakvsealekrysmtehkrqvpasmfddwwk

SCOPe Domain Coordinates for d1fyda_:

Click to download the PDB-style file with coordinates for d1fyda_.
(The format of our PDB-style files is described here.)

Timeline for d1fyda_: