Lineage for d1fyda_ (1fyd A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68936Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
  4. 69036Superfamily c.26.2: Adenine nucleotide alpha hydrolases [52402] (2 families) (S)
  5. 69037Family c.26.2.1: N-type ATP pyrophosphatases [52403] (3 proteins)
  6. 69050Protein NH3-dependent NAD+-synthetase [52406] (1 species)
  7. 69051Species Bacillus subtilis [TaxId:1423] [52407] (6 PDB entries)
  8. 69060Domain d1fyda_: 1fyd A: [60113]

Details for d1fyda_

PDB Entry: 1fyd (more details), 2.25 Å

PDB Description: crystal structure of nh3-dependent nad+ synthetase from bacillus subtilis complexed with one molecule amp, one pyrophosphate ion and one mg2+ ion

SCOP Domain Sequences for d1fyda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fyda_ c.26.2.1 (A:) NH3-dependent NAD+-synthetase {Bacillus subtilis}
smqekimrelhvkpsidpkqeiedrvnflkqyvkktgakgfvlgisggqdstlagrlaql
avesireeggdaqfiavrlphgtqqdeddaqlalkfikpdkswkfdikstvsafsdqyqq
etgdqltdfnkgnvkartrmiaqyaiggqegllvlgtdhaaeavtgfftkygdggadllp
ltgltkrqgrtllkelgaperlylkeptadlldekpqqsdetelgisydeiddylegkev
sakvsealekrysmtehkrqvpasmfddwwk

SCOP Domain Coordinates for d1fyda_:

Click to download the PDB-style file with coordinates for d1fyda_.
(The format of our PDB-style files is described here.)

Timeline for d1fyda_: