Lineage for d1fwxb2 (1fwx B:9-451)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2808830Superfamily b.69.3: Nitrous oxide reductase, N-terminal domain [50974] (1 family) (S)
  5. 2808831Family b.69.3.1: Nitrous oxide reductase, N-terminal domain [50975] (2 proteins)
  6. 2808832Protein Nitrous oxide reductase, N-terminal domain [50976] (2 species)
  7. 2808833Species Paracoccus denitrificans [TaxId:266] [63833] (1 PDB entry)
  8. 2808835Domain d1fwxb2: 1fwx B:9-451 [60072]
    Other proteins in same PDB: d1fwxa1, d1fwxb1, d1fwxc1, d1fwxd1
    complexed with ca, cl, cua, cuz

Details for d1fwxb2

PDB Entry: 1fwx (more details), 1.6 Å

PDB Description: crystal structure of nitrous oxide reductase from p. denitrificans
PDB Compounds: (B:) nitrous oxide reductase

SCOPe Domain Sequences for d1fwxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwxb2 b.69.3.1 (B:9-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]}
dgsvapgqlddyygfwssgqsgemrilgipsmrelmrvpvfnrcsatgwgqtnesvrihe
rtmsertkkflaangkrihdngdlhhvhmsftegkydgrflfmndkantrvarvrcdvmk
cdaileipnakgihglrpqkwprsnyvfcngedetplvndgtnmedvanyvnvftavdad
kwevawqvlvsgnldncdadyegkwafstsynsekgmtlpemtaaemdhivvfniaeiek
aiaagdyqelngvkvvdgrkeasslftryipiannphgcnmapdkkhlcvagklsptvtv
ldvtrfdavfyenadprsavvaepelglgplhtafdgrgnaytslfldsqvvkwniedai
rayagekvdpikdkldvhyqpghlktvmgetldatndwlvclskfskdrflnvgplkpen
dqlidisgdkmvlvhdgptfaephdaiavhpsilsdik

SCOPe Domain Coordinates for d1fwxb2:

Click to download the PDB-style file with coordinates for d1fwxb2.
(The format of our PDB-style files is described here.)

Timeline for d1fwxb2: