Lineage for d1fwxb2 (1fwx B:9-451)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62854Fold b.69: 7-bladed beta-propeller [50964] (7 superfamilies)
  4. 62875Superfamily b.69.3: Nitrous oxide reductase, N-terminal domain [50974] (1 family) (S)
  5. 62876Family b.69.3.1: Nitrous oxide reductase, N-terminal domain [50975] (1 protein)
  6. 62877Protein Nitrous oxide reductase, N-terminal domain [50976] (2 species)
  7. 62878Species Paracoccus denitrificans [TaxId:266] [63833] (1 PDB entry)
  8. 62880Domain d1fwxb2: 1fwx B:9-451 [60072]
    Other proteins in same PDB: d1fwxa1, d1fwxb1, d1fwxc1, d1fwxd1

Details for d1fwxb2

PDB Entry: 1fwx (more details), 1.6 Å

PDB Description: crystal structure of nitrous oxide reductase from p. denitrificans

SCOP Domain Sequences for d1fwxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwxb2 b.69.3.1 (B:9-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans}
dgsvapgqlddyygfwssgqsgemrilgipsmrelmrvpvfnrcsatgwgqtnesvrihe
rtmsertkkflaangkrihdngdlhhvhmsftegkydgrflfmndkantrvarvrcdvmk
cdaileipnakgihglrpqkwprsnyvfcngedetplvndgtnmedvanyvnvftavdad
kwevawqvlvsgnldncdadyegkwafstsynsekgmtlpemtaaemdhivvfniaeiek
aiaagdyqelngvkvvdgrkeasslftryipiannphgcnmapdkkhlcvagklsptvtv
ldvtrfdavfyenadprsavvaepelglgplhtafdgrgnaytslfldsqvvkwniedai
rayagekvdpikdkldvhyqpghlktvmgetldatndwlvclskfskdrflnvgplkpen
dqlidisgdkmvlvhdgptfaephdaiavhpsilsdik

SCOP Domain Coordinates for d1fwxb2:

Click to download the PDB-style file with coordinates for d1fwxb2.
(The format of our PDB-style files is described here.)

Timeline for d1fwxb2: