Lineage for d1fwxb1 (1fwx B:452-580)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2367899Family b.6.1.4: Nitrosocyanin [63392] (2 protein domains)
  6. 2367900Protein Nitrous oxide reductase, C-terminal domain [49548] (2 species)
  7. 2367901Species Paracoccus denitrificans [TaxId:266] [63690] (1 PDB entry)
  8. 2367903Domain d1fwxb1: 1fwx B:452-580 [60071]
    Other proteins in same PDB: d1fwxa2, d1fwxb2, d1fwxc2, d1fwxd2
    complexed with ca, cl, cua, cuz

Details for d1fwxb1

PDB Entry: 1fwx (more details), 1.6 Å

PDB Description: crystal structure of nitrous oxide reductase from p. denitrificans
PDB Compounds: (B:) nitrous oxide reductase

SCOPe Domain Sequences for d1fwxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwxb1 b.6.1.4 (B:452-580) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]}
svwdrndpmwaetraqaeadgvdidnwteevirdgnkvrvymssvapsfsiesftvkegd
evtvivtnldeiddlthgftmgnygvameigpqmtssvtfvaanpgvywyycqwfchalh
memrgrmlvep

SCOPe Domain Coordinates for d1fwxb1:

Click to download the PDB-style file with coordinates for d1fwxb1.
(The format of our PDB-style files is described here.)

Timeline for d1fwxb1: