PDB entry 1fwx

View 1fwx on RCSB PDB site
Description: crystal structure of nitrous oxide reductase from p. denitrificans
Class: oxidoreductase
Keywords: Beta-propeller domain, cupredoxin domain, CuZ site, CuA site, OXIDOREDUCTASE
Deposited on 2000-09-25, released 2001-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrous oxide reductase
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51705
      • see remark 999 (300)
      • see remark 999 (2)
    Domains in SCOPe 2.07: d1fwxa1, d1fwxa2
  • Chain 'B':
    Compound: nitrous oxide reductase
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51705
      • see remark 999 (300)
    Domains in SCOPe 2.07: d1fwxb1, d1fwxb2
  • Chain 'C':
    Compound: nitrous oxide reductase
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51705
      • see remark 999 (300)
    Domains in SCOPe 2.07: d1fwxc1, d1fwxc2
  • Chain 'D':
    Compound: nitrous oxide reductase
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51705
      • see remark 999 (300)
    Domains in SCOPe 2.07: d1fwxd1, d1fwxd2
  • Heterogens: CL, CA, CUA, CUZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fwxA (A:)
    asadgsvapgqlddyygfwssgqsgemrilgipsmrelmrvpvfnrcsatgwgqtnesvr
    ihertmsertkkflaangkrihdngdlhhvhmsftegkydgrflfmndkantrvarvrcd
    vmkcdaileipnakgihglrpqkwprsnyvfcngedetplvndgtnmedvanyvnvftav
    dadkwevawqvlvsgnldncdadyegkwafstsynsekgmtlpemtaaemdhivvfniae
    iekaiaagdyqelngvkvvdgrkeasslftryipiannphgcnmapdkkhlcvagklspt
    vtvldvtrfdavfyenadprsavvaepelglgplhtafdgrgnaytslfldsqvvkwnie
    dairayagekvdpikdkldvhyqpghlktvmgetldatndwlvclskfskdrflnvgplk
    pendqlidisgdkmvlvhdgptfaephdaiavhpsilsdiksvwdrndpmwaetraqaea
    dgvdidnwteevirdgnkvrvymssvapsfsiesftvkegdevtvivtnldeiddlthgf
    tmgnygvameigpqmtssvtfvaanpgvywyycqwfchalhmemrgrmlvepkea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fwxA (A:)
    adgsvapgqlddyygfwssgqsgemrilgipsmrelmrvpvfnrcsatgwgqtnesvrih
    ertmsertkkflaangkrihdngdlhhvhmsftegkydgrflfmndkantrvarvrcdvm
    kcdaileipnakgihglrpqkwprsnyvfcngedetplvndgtnmedvanyvnvftavda
    dkwevawqvlvsgnldncdadyegkwafstsynsekgmtlpemtaaemdhivvfniaeie
    kaiaagdyqelngvkvvdgrkeasslftryipiannphgcnmapdkkhlcvagklsptvt
    vldvtrfdavfyenadprsavvaepelglgplhtafdgrgnaytslfldsqvvkwnieda
    irayagekvdpikdkldvhyqpghlktvmgetldatndwlvclskfskdrflnvgplkpe
    ndqlidisgdkmvlvhdgptfaephdaiavhpsilsdiksvwdrndpmwaetraqaeadg
    vdidnwteevirdgnkvrvymssvapsfsiesftvkegdevtvivtnldeiddlthgftm
    gnygvameigpqmtssvtfvaanpgvywyycqwfchalhmemrgrmlvepk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fwxB (B:)
    asadgsvapgqlddyygfwssgqsgemrilgipsmrelmrvpvfnrcsatgwgqtnesvr
    ihertmsertkkflaangkrihdngdlhhvhmsftegkydgrflfmndkantrvarvrcd
    vmkcdaileipnakgihglrpqkwprsnyvfcngedetplvndgtnmedvanyvnvftav
    dadkwevawqvlvsgnldncdadyegkwafstsynsekgmtlpemtaaemdhivvfniae
    iekaiaagdyqelngvkvvdgrkeasslftryipiannphgcnmapdkkhlcvagklspt
    vtvldvtrfdavfyenadprsavvaepelglgplhtafdgrgnaytslfldsqvvkwnie
    dairayagekvdpikdkldvhyqpghlktvmgetldatndwlvclskfskdrflnvgplk
    pendqlidisgdkmvlvhdgptfaephdaiavhpsilsdiksvwdrndpmwaetraqaea
    dgvdidnwteevirdgnkvrvymssvapsfsiesftvkegdevtvivtnldeiddlthgf
    tmgnygvameigpqmtssvtfvaanpgvywyycqwfchalhmemrgrmlvepkea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fwxB (B:)
    dgsvapgqlddyygfwssgqsgemrilgipsmrelmrvpvfnrcsatgwgqtnesvrihe
    rtmsertkkflaangkrihdngdlhhvhmsftegkydgrflfmndkantrvarvrcdvmk
    cdaileipnakgihglrpqkwprsnyvfcngedetplvndgtnmedvanyvnvftavdad
    kwevawqvlvsgnldncdadyegkwafstsynsekgmtlpemtaaemdhivvfniaeiek
    aiaagdyqelngvkvvdgrkeasslftryipiannphgcnmapdkkhlcvagklsptvtv
    ldvtrfdavfyenadprsavvaepelglgplhtafdgrgnaytslfldsqvvkwniedai
    rayagekvdpikdkldvhyqpghlktvmgetldatndwlvclskfskdrflnvgplkpen
    dqlidisgdkmvlvhdgptfaephdaiavhpsilsdiksvwdrndpmwaetraqaeadgv
    didnwteevirdgnkvrvymssvapsfsiesftvkegdevtvivtnldeiddlthgftmg
    nygvameigpqmtssvtfvaanpgvywyycqwfchalhmemrgrmlvep
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fwxC (C:)
    asadgsvapgqlddyygfwssgqsgemrilgipsmrelmrvpvfnrcsatgwgqtnesvr
    ihertmsertkkflaangkrihdngdlhhvhmsftegkydgrflfmndkantrvarvrcd
    vmkcdaileipnakgihglrpqkwprsnyvfcngedetplvndgtnmedvanyvnvftav
    dadkwevawqvlvsgnldncdadyegkwafstsynsekgmtlpemtaaemdhivvfniae
    iekaiaagdyqelngvkvvdgrkeasslftryipiannphgcnmapdkkhlcvagklspt
    vtvldvtrfdavfyenadprsavvaepelglgplhtafdgrgnaytslfldsqvvkwnie
    dairayagekvdpikdkldvhyqpghlktvmgetldatndwlvclskfskdrflnvgplk
    pendqlidisgdkmvlvhdgptfaephdaiavhpsilsdiksvwdrndpmwaetraqaea
    dgvdidnwteevirdgnkvrvymssvapsfsiesftvkegdevtvivtnldeiddlthgf
    tmgnygvameigpqmtssvtfvaanpgvywyycqwfchalhmemrgrmlvepkea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fwxC (C:)
    dgsvapgqlddyygfwssgqsgemrilgipsmrelmrvpvfnrcsatgwgqtnesvrihe
    rtmsertkkflaangkrihdngdlhhvhmsftegkydgrflfmndkantrvarvrcdvmk
    cdaileipnakgihglrpqkwprsnyvfcngedetplvndgtnmedvanyvnvftavdad
    kwevawqvlvsgnldncdadyegkwafstsynsekgmtlpemtaaemdhivvfniaeiek
    aiaagdyqelngvkvvdgrkeasslftryipiannphgcnmapdkkhlcvagklsptvtv
    ldvtrfdavfyenadprsavvaepelglgplhtafdgrgnaytslfldsqvvkwniedai
    rayagekvdpikdkldvhyqpghlktvmgetldatndwlvclskfskdrflnvgplkpen
    dqlidisgdkmvlvhdgptfaephdaiavhpsilsdiksvwdrndpmwaetraqaeadgv
    didnwteevirdgnkvrvymssvapsfsiesftvkegdevtvivtnldeiddlthgftmg
    nygvameigpqmtssvtfvaanpgvywyycqwfchalhmemrgrmlvepk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1fwxD (D:)
    asadgsvapgqlddyygfwssgqsgemrilgipsmrelmrvpvfnrcsatgwgqtnesvr
    ihertmsertkkflaangkrihdngdlhhvhmsftegkydgrflfmndkantrvarvrcd
    vmkcdaileipnakgihglrpqkwprsnyvfcngedetplvndgtnmedvanyvnvftav
    dadkwevawqvlvsgnldncdadyegkwafstsynsekgmtlpemtaaemdhivvfniae
    iekaiaagdyqelngvkvvdgrkeasslftryipiannphgcnmapdkkhlcvagklspt
    vtvldvtrfdavfyenadprsavvaepelglgplhtafdgrgnaytslfldsqvvkwnie
    dairayagekvdpikdkldvhyqpghlktvmgetldatndwlvclskfskdrflnvgplk
    pendqlidisgdkmvlvhdgptfaephdaiavhpsilsdiksvwdrndpmwaetraqaea
    dgvdidnwteevirdgnkvrvymssvapsfsiesftvkegdevtvivtnldeiddlthgf
    tmgnygvameigpqmtssvtfvaanpgvywyycqwfchalhmemrgrmlvepkea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fwxD (D:)
    gsvapgqlddyygfwssgqsgemrilgipsmrelmrvpvfnrcsatgwgqtnesvriher
    tmsertkkflaangkrihdngdlhhvhmsftegkydgrflfmndkantrvarvrcdvmkc
    daileipnakgihglrpqkwprsnyvfcngedetplvndgtnmedvanyvnvftavdadk
    wevawqvlvsgnldncdadyegkwafstsynsekgmtlpemtaaemdhivvfniaeieka
    iaagdyqelngvkvvdgrkeasslftryipiannphgcnmapdkkhlcvagklsptvtvl
    dvtrfdavfyenadprsavvaepelglgplhtafdgrgnaytslfldsqvvkwniedair
    ayagekvdpikdkldvhyqpghlktvmgetldatndwlvclskfskdrflnvgplkpend
    qlidisgdkmvlvhdgptfaephdaiavhpsilsdiksvwdrndpmwaetraqaeadgvd
    idnwteevirdgnkvrvymssvapsfsiesftvkegdevtvivtnldeiddlthgftmgn
    ygvameigpqmtssvtfvaanpgvywyycqwfchalhmemrgrmlvep