SCOPe 2.01: Domain d1fw1a1: 1fw1 A:88-212

Lineage for d1fw1a1 (1fw1 A:88-212)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class zeta GST [81353] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63555] (1 PDB entry)
   maleylacetoacetate isomerase

8. Domain d1fw1a1: 1fw1 A:88-212 [60051]
   Other proteins in same PDB: d1fw1a2
   complexed with dtt, gsh, so4

Details for d1fw1a1

PDB Entry: 1fw1, 1.9 Å

PDB Description: Glutathione transferase zeta/maleylacetoacetate isomerase

PDB Compounds: (A:) glutathione transferase zeta

SCOPe Domain Sequences for d1fw1a1:

Sequence; same for both SEQRES and ATOM records:

>d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]}
llpqdpkkrasvrmisdliaggiqplqnlsvlkqvgeemqltwaqnaitcgfnaleqilq
stagiycvgdevtmadlclvpqvanaerfkvdltpyptissinkrllvleafqvshpcrq
pdtpt

Timeline for d1fw1a1:

• d1fw1a1 first appeared in SCOP 1.57
  
• d1fw1a1 appears in SCOP 1.75
  
• d1fw1a1 appears in SCOPe 2.02
  
• d1fw1a1 appears in the current release, SCOPe 2.08