Lineage for d1fw1a1 (1fw1 A:88-212)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 915607Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 915608Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 915609Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 916097Protein Class zeta GST [81353] (2 species)
  7. 916098Species Human (Homo sapiens) [TaxId:9606] [63555] (1 PDB entry)
    maleylacetoacetate isomerase
  8. 916099Domain d1fw1a1: 1fw1 A:88-212 [60051]
    Other proteins in same PDB: d1fw1a2
    complexed with dtt, gsh, so4

Details for d1fw1a1

PDB Entry: 1fw1 (more details), 1.9 Å

PDB Description: Glutathione transferase zeta/maleylacetoacetate isomerase
PDB Compounds: (A:) glutathione transferase zeta

SCOPe Domain Sequences for d1fw1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]}
llpqdpkkrasvrmisdliaggiqplqnlsvlkqvgeemqltwaqnaitcgfnaleqilq
stagiycvgdevtmadlclvpqvanaerfkvdltpyptissinkrllvleafqvshpcrq
pdtpt

SCOPe Domain Coordinates for d1fw1a1:

Click to download the PDB-style file with coordinates for d1fw1a1.
(The format of our PDB-style files is described here.)

Timeline for d1fw1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fw1a2