Lineage for d1fw1a1 (1fw1 A:88-212)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily) Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) 
Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (3 proteins) Protein Glutathione S-transferase [47618] (24 species) 
Species Human (Homo sapiens), class zeta [TaxId:9606] [63555] (1 PDB entry) 
Domain d1fw1a1: 1fw1 A:88-212 [60051]
Other proteins in same PDB: d1fw1a2
Details for d1fw1a1
PDB Entry: 1fw1 (more details), 1.9 Å
PDB Description: Glutathione transferase zeta/maleylacetoacetate isomerase
SCOP Domain Sequences for d1fw1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fw1a1 a.45.1.1 (A:88-212) Glutathione S-transferase {Human (Homo sapiens), class zeta}
llpqdpkkrasvrmisdliaggiqplqnlsvlkqvgeemqltwaqnaitcgfnaleqilq
stagiycvgdevtmadlclvpqvanaerfkvdltpyptissinkrllvleafqvshpcrq
pdtpt
SCOP Domain Coordinates for d1fw1a1:
Click to download the PDB-style file with coordinates for d1fw1a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fw1a1:
- d1fw1a1 is new in SCOP 1.57
- d1fw1a1 appears in SCOP 1.59
- d1fw1a1 appears in the current release, SCOPe 2.08
View in 3D
