Lineage for d1fs0e1 (1fs0 E:87-134)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690016Superfamily a.2.10: Epsilon subunit of F1F0-ATP synthase C-terminal domain [46604] (2 families) (S)
  5. 2690017Family a.2.10.1: Epsilon subunit of F1F0-ATP synthase C-terminal domain [46605] (1 protein)
  6. 2690018Protein Epsilon subunit of F1F0-ATP synthase C-terminal domain [46606] (3 species)
    delta subunit in mitochondria
    this domain unfolds when bound to the gamma subunit
  7. 2690031Species Escherichia coli [TaxId:562] [46607] (4 PDB entries)
  8. 2690035Domain d1fs0e1: 1fs0 E:87-134 [59997]
    Other proteins in same PDB: d1fs0e2, d1fs0g_

Details for d1fs0e1

PDB Entry: 1fs0 (more details), 2.1 Å

PDB Description: complex of gamma/epsilon atp synthase from e.coli
PDB Compounds: (E:) ATP synthase epsilon subunit

SCOPe Domain Sequences for d1fs0e1:

Sequence, based on SEQRES records: (download)

>d1fs0e1 a.2.10.1 (E:87-134) Epsilon subunit of F1F0-ATP synthase C-terminal domain {Escherichia coli [TaxId: 562]}
qdldearameakrkaeehissshgdvdyaqasaelakaiaqlrvielt

Sequence, based on observed residues (ATOM records): (download)

>d1fs0e1 a.2.10.1 (E:87-134) Epsilon subunit of F1F0-ATP synthase C-terminal domain {Escherichia coli [TaxId: 562]}
qdldearameakrkaeehdvdyaqasaelakaiaqlrvielt

SCOPe Domain Coordinates for d1fs0e1:

Click to download the PDB-style file with coordinates for d1fs0e1.
(The format of our PDB-style files is described here.)

Timeline for d1fs0e1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fs0e2
View in 3D
Domains from other chains:
(mouse over for more information)
d1fs0g_