SCOPe 2.08: Domain d1fs0e2: 1fs0 E:1-86

Lineage for d1fs0e2 (1fs0 E:1-86)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily)
   pseudobarrel: sandwich of two sheets packed at a positive interstrand angle and interconnected with many short turns

4. Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family)

5. Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (2 proteins)

6. Protein Epsilon subunit of F1F0-ATP synthase N-terminal domain [51346] (3 species)
   delta subunit in mitochondria

7. Species Escherichia coli [TaxId:562] [51347] (4 PDB entries)

8. Domain d1fs0e2: 1fs0 E:1-86 [59998]
   Other proteins in same PDB: d1fs0e1, d1fs0g_

Details for d1fs0e2

PDB Entry: 1fs0, 2.1 Å

PDB Description: complex of gamma/epsilon atp synthase from e.coli

PDB Compounds: (E:) ATP synthase epsilon subunit

SCOPe Domain Sequences for d1fs0e2:

Sequence; same for both SEQRES and ATOM records:

>d1fs0e2 b.93.1.1 (E:1-86) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Escherichia coli [TaxId: 562]}
amtyhldvvsaeqqmfsglvekiqvtgsegelgiypghaplltaikpgmirivkqhghee
fiylsggilevqpgnvtvladtairg

Timeline for d1fs0e2:

• d1fs0e2 first appeared in SCOP 1.57
  
• d1fs0e2 appears in SCOPe 2.07