PDB entry 1fs0

View 1fs0 on RCSB PDB site
Description: complex of gamma/epsilon ATP synthase from e.coli
Class: hydrolase
Keywords: ATP Synthase, Coiled coil, Gamma, epsilon, HYDROLASE
Deposited on 2000-09-07, released 2001-05-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.216
AEROSPACI score: -1.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: ATP synthase epsilon subunit
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1fs0e1, d1fs0e2
  • Chain 'G':
    Compound: ATP synthase gamma subunit
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1fs0g_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1fs0E (E:)
    amtyhldvvsaeqqmfsglvekiqvtgsegelgiypghaplltaikpgmirivkqhghee
    fiylsggilevqpgnvtvladtairgqdldearameakrkaeehissshgdvdyaqasae
    lakaiaqlrvieltkkam
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fs0E (E:)
    amtyhldvvsaeqqmfsglvekiqvtgsegelgiypghaplltaikpgmirivkqhghee
    fiylsggilevqpgnvtvladtairgqdldearameakrkaeehdvdyaqasaelakaia
    qlrvielt
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1fs0G (G:)
    kitkamemvaaskmrksqdrmaasrpyaetmrkvighlahgnleykhpyledrdvkrvgy
    lvvstdrglcgglninlfkkllaemktwtdkgvqcdlamigskgvsffnsvggnvvaqvt
    gmgdnpslseligpvkvmlqaydegrldklyivsnkfintmsqvptisqllplpasdddd
    lkhkswdylyepdpkalldtllrryvesqvyqgvvenlaseqaarmvamk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fs0G (G:)
    kitkamemvaaskmrksqdrmaasrpyaetmrkvighlahykhpyledrdvkrvgylvvs
    tdrglcgglninlfkkllaemktwtdkgvqcdlamigskgvsffnsvggnvvaqvtgmgd
    npslseligpvkvmlqaydegrldklyivsnkfintmsqvptisqllplpkhkswdylye
    pdpkalldtllrryvesqvyqgvvenlaseqaarmvamk