Lineage for d1fr0a_ (1fr0 A:)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.24: Four-helical up-and-down bundle [47161] (12 superfamilies) 
Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (3 families) 
Family a.24.10.1: Aerobic respiration control sensor protein, ArcB [47227] (1 protein) Protein Aerobic respiration control sensor protein, ArcB [47228] (1 species) Species Escherichia coli [TaxId:562] [47229] (4 PDB entries) 
Domain d1fr0a_: 1fr0 A: [59996]
Details for d1fr0a_
PDB Entry: 1fr0 (more details)
PDB Description: solution structure of the histidine-containing phosphotransfer domain of anaerobic sensor kinase arcb from escherichia coli.
SCOP Domain Sequences for d1fr0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fr0a_ a.24.10.1 (A:) Aerobic respiration control sensor protein, ArcB {Escherichia coli}
tteensksealldipmleqylelvgpklitdglavfekmmpgyvsvlesnltaqdkkgiv
eeghkikgaagsvglrhlqqlgqqiqspdlpawednvgewieemkeewrhdvevlkawva
katkk
SCOP Domain Coordinates for d1fr0a_:
Click to download the PDB-style file with coordinates for d1fr0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fr0a_:
- d1fr0a_ is new in SCOP 1.57
- d1fr0a_ appears in SCOP 1.59
- d1fr0a_ appears in the current release, SCOPe 2.08
View in 3D