Lineage for d1fr0a_ (1fr0 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311272Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2311859Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families) (S)
    contains additional, fifth helix at the N-terminus
  5. 2311860Family a.24.10.1: Aerobic respiration control sensor protein, ArcB [47227] (1 protein)
  6. 2311861Protein Aerobic respiration control sensor protein, ArcB [47228] (1 species)
  7. 2311862Species Escherichia coli [TaxId:562] [47229] (4 PDB entries)
  8. 2311866Domain d1fr0a_: 1fr0 A: [59996]

Details for d1fr0a_

PDB Entry: 1fr0 (more details)

PDB Description: solution structure of the histidine-containing phosphotransfer domain of anaerobic sensor kinase arcb from escherichia coli.
PDB Compounds: (A:) arcb

SCOPe Domain Sequences for d1fr0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fr0a_ a.24.10.1 (A:) Aerobic respiration control sensor protein, ArcB {Escherichia coli [TaxId: 562]}
tteensksealldipmleqylelvgpklitdglavfekmmpgyvsvlesnltaqdkkgiv
eeghkikgaagsvglrhlqqlgqqiqspdlpawednvgewieemkeewrhdvevlkawva
katkk

SCOPe Domain Coordinates for d1fr0a_:

Click to download the PDB-style file with coordinates for d1fr0a_.
(The format of our PDB-style files is described here.)

Timeline for d1fr0a_: