Lineage for d1fr0a_ (1fr0 A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 96219Fold a.24: Four-helical up-and-down bundle [47161] (14 superfamilies)
  4. 96387Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (3 families) (S)
  5. 96388Family a.24.10.1: Aerobic respiration control sensor protein, ArcB [47227] (1 protein)
  6. 96389Protein Aerobic respiration control sensor protein, ArcB [47228] (1 species)
  7. 96390Species Escherichia coli [TaxId:562] [47229] (4 PDB entries)
  8. 96394Domain d1fr0a_: 1fr0 A: [59996]

Details for d1fr0a_

PDB Entry: 1fr0 (more details)

PDB Description: solution structure of the histidine-containing phosphotransfer domain of anaerobic sensor kinase arcb from escherichia coli.

SCOP Domain Sequences for d1fr0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fr0a_ a.24.10.1 (A:) Aerobic respiration control sensor protein, ArcB {Escherichia coli}
tteensksealldipmleqylelvgpklitdglavfekmmpgyvsvlesnltaqdkkgiv
eeghkikgaagsvglrhlqqlgqqiqspdlpawednvgewieemkeewrhdvevlkawva
katkk

SCOP Domain Coordinates for d1fr0a_:

Click to download the PDB-style file with coordinates for d1fr0a_.
(The format of our PDB-style files is described here.)

Timeline for d1fr0a_: