PDB entry 1fr0

View 1fr0 on RCSB PDB site
Description: solution structure of the histidine-containing phosphotransfer domain of anaerobic sensor kinase arcb from escherichia coli.
Deposited on 2000-09-07, released 2001-03-14
The last revision prior to the SCOP 1.57 freeze date was dated 2001-03-14, with a file datestamp of 2001-03-14.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.57: d1fr0a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fr0A (A:)
  tteensksealldipmleqylelvgpklitdglavfekmmpgyvsvlesnltaqdkkgiv
  eeghkikgaagsvglrhlqqlgqqiqspdlpawednvgewieemkeewrhdvevlkawva
  katkk