Lineage for d1fpqa1 (1fpq A:20-128)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149792Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 150081Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (35 families) (S)
  5. 150421Family a.4.5.29: Plant O-methyltransferase, N-terminal domain [63475] (3 proteins)
  6. 150430Protein Chalcone O-methyltransferase [63476] (1 species)
  7. 150431Species Alfalfa (Medicago sativa) [TaxId:3879] [63477] (2 PDB entries)
  8. 150433Domain d1fpqa1: 1fpq A:20-128 [59947]
    Other proteins in same PDB: d1fpqa2

Details for d1fpqa1

PDB Entry: 1fpq (more details), 2 Å

PDB Description: crystal structure analysis of selenomethionine substituted chalcone o-methyltransferase

SCOP Domain Sequences for d1fpqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fpqa1 a.4.5.29 (A:20-128) Chalcone O-methyltransferase {Alfalfa (Medicago sativa)}
tedsaclsamvlttnlvypavlnaaidlnlfeiiakatppgafmspseiasklpastqhs
dlpnrldrmlrllasysvltsttrtiedggaervyglsmvgkylvpdes

SCOP Domain Coordinates for d1fpqa1:

Click to download the PDB-style file with coordinates for d1fpqa1.
(The format of our PDB-style files is described here.)

Timeline for d1fpqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fpqa2