Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.29: Plant O-methyltransferase, N-terminal domain [63475] (5 proteins) unknown function |
Protein Chalcone O-methyltransferase [63476] (1 species) |
Species Alfalfa (Medicago sativa) [TaxId:3879] [63477] (2 PDB entries) |
Domain d1fpqa1: 1fpq A:20-128 [59947] Other proteins in same PDB: d1fpqa2 complexed with sam |
PDB Entry: 1fpq (more details), 2 Å
SCOPe Domain Sequences for d1fpqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fpqa1 a.4.5.29 (A:20-128) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} tedsaclsamvlttnlvypavlnaaidlnlfeiiakatppgafmspseiasklpastqhs dlpnrldrmlrllasysvltsttrtiedggaervyglsmvgkylvpdes
Timeline for d1fpqa1: