SCOPe 2.08: Domain d1fpqa1: 1fpq A:20-128

Lineage for d1fpqa1 (1fpq A:20-128)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.29: Plant O-methyltransferase, N-terminal domain [63475] (5 proteins)
   unknown function

6. Protein Chalcone O-methyltransferase [63476] (1 species)

7. Species Alfalfa (Medicago sativa) [TaxId:3879] [63477] (2 PDB entries)

8. Domain d1fpqa1: 1fpq A:20-128 [59947]
   Other proteins in same PDB: d1fpqa2
   complexed with sam

Details for d1fpqa1

PDB Entry: 1fpq, 2 Å

PDB Description: crystal structure analysis of selenomethionine substituted chalcone o-methyltransferase

PDB Compounds: (A:) isoliquiritigenin 2'-o-methyltransferase

SCOPe Domain Sequences for d1fpqa1:

Sequence; same for both SEQRES and ATOM records:

>d1fpqa1 a.4.5.29 (A:20-128) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}
tedsaclsamvlttnlvypavlnaaidlnlfeiiakatppgafmspseiasklpastqhs
dlpnrldrmlrllasysvltsttrtiedggaervyglsmvgkylvpdes

Timeline for d1fpqa1:

• d1fpqa1 first appeared in SCOP 1.57
  
• d1fpqa1 appears in SCOPe 2.07