Lineage for d1fpqa1 (1fpq A:20-128)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies) Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (31 families) 
Family a.4.5.29: Plant O-methyltransferase, N-terminal domain [63475] (2 proteins) 
Protein Chalcone O-methyltransferase [63476] (1 species) Species Alfalfa (Medicago sativa) [TaxId:3879] [63477] (2 PDB entries) 
Domain d1fpqa1: 1fpq A:20-128 [59947]
Other proteins in same PDB: d1fpqa2
Details for d1fpqa1
PDB Entry: 1fpq (more details), 2 Å
PDB Description: crystal structure analysis of selenomethionine substituted chalcone o-methyltransferase
SCOP Domain Sequences for d1fpqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fpqa1 a.4.5.29 (A:20-128) Chalcone O-methyltransferase {Alfalfa (Medicago sativa)}
tedsaclsamvlttnlvypavlnaaidlnlfeiiakatppgafmspseiasklpastqhs
dlpnrldrmlrllasysvltsttrtiedggaervyglsmvgkylvpdes
SCOP Domain Coordinates for d1fpqa1:
Click to download the PDB-style file with coordinates for d1fpqa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fpqa1:
- d1fpqa1 is new in SCOP 1.57
- d1fpqa1 appears in SCOP 1.59
- d1fpqa1 appears in the current release, SCOPe 2.08
View in 3D
