Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins) |
Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species) |
Species Mouse (Mus musculus), I-EK [TaxId:10090] [54465] (7 PDB entries) |
Domain d1fngd2: 1fng D:4-92 [59911] Other proteins in same PDB: d1fnga1, d1fngb1, d1fngc1, d1fngd1 contains covalently bound peptides at the N-termini of chains B and D complexed with nag |
PDB Entry: 1fng (more details), 1.9 Å
SCOP Domain Sequences for d1fngd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fngd2 d.19.1.1 (D:4-92) MHC class II, N-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-EK} rpwfleycksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwns qpefleqkraevdtvcrhnyeifdnflvp
Timeline for d1fngd2: