Lineage for d1fnea1 (1fne A:82-182)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159086Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)
  7. 159180Species Mouse (Mus musculus), I-EK [TaxId:10090] [49139] (7 PDB entries)
  8. 159185Domain d1fnea1: 1fne A:82-182 [59896]
    Other proteins in same PDB: d1fnea2, d1fneb2, d1fnec2, d1fned2

Details for d1fnea1

PDB Entry: 1fne (more details), 1.9 Å

PDB Description: histocompatibility antigen

SCOP Domain Sequences for d1fnea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnea1 b.1.1.2 (A:82-182) Class II MHC, C-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-EK}
danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd
dhlfrkfhyltflpstddfydcevdhwgleeplrkhwefee

SCOP Domain Coordinates for d1fnea1:

Click to download the PDB-style file with coordinates for d1fnea1.
(The format of our PDB-style files is described here.)

Timeline for d1fnea1: