Lineage for d1fexa_ (1fex A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1720411Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1720667Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)
  6. 1720719Protein Rap1 [63467] (1 species)
  7. 1720720Species Human (Homo sapiens) [TaxId:9606] [63468] (1 PDB entry)
  8. 1720721Domain d1fexa_: 1fex A: [59803]

Details for d1fexa_

PDB Entry: 1fex (more details)

PDB Description: solution structure of myb-domain of human rap1
PDB Compounds: (A:) trf2-interacting telomeric rap1 protein

SCOPe Domain Sequences for d1fexa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]}
griaftdaddvailtyvkenarspssvtgnalwkamekssltqhswqslkdrylkhlrg

SCOPe Domain Coordinates for d1fexa_:

Click to download the PDB-style file with coordinates for d1fexa_.
(The format of our PDB-style files is described here.)

Timeline for d1fexa_: