PDB entry 1fex

View 1fex on RCSB PDB site
Description: solution structure of myb-domain of human rap1
Class: structural protein
Keywords: HELIX TURN HELIX, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, STRUCTURAL PROTEIN
Deposited on 2000-07-24, released 2001-09-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trf2-interacting telomeric rap1 protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1fexa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fexA (A:)
    griaftdaddvailtyvkenarspssvtgnalwkamekssltqhswqslkdrylkhlrg