SCOPe 2.06: Domain d1fe3a_: 1fe3 A:

Lineage for d1fe3a_ (1fe3 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Brain fatty acid binding protein [63809] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63810] (3 PDB entries)

8. Domain d1fe3a_: 1fe3 A: [59780]
   complexed with oleic acid
   complexed with ola

Details for d1fe3a_

PDB Entry: 1fe3, 2.8 Å

PDB Description: crystal structure of human brain fatty acid binding protein oleic acid

PDB Compounds: (A:) fatty acid-binding protein, brain

SCOPe Domain Sequences for d1fe3a_:

Sequence; same for both SEQRES and ATOM records:

>d1fe3a_ b.60.1.2 (A:) Brain fatty acid binding protein {Human (Homo sapiens) [TaxId: 9606]}
veafcatwkltnsqnfdeymkalgvgfatrqvgnvtkptviisqegdkvvirtlstfknt
eisfqlgeefdettaddrncksvvsldgdklvhiqkwdgketnfvreikdgkmvmtltfg
dvvavrhyeka

Timeline for d1fe3a_:

• d1fe3a_ first appeared in SCOP 1.57
  
• d1fe3a_ appears in SCOPe 2.05
  
• d1fe3a_ appears in SCOPe 2.07
  
• d1fe3a_ appears in the current release, SCOPe 2.08