Lineage for d1fe3a_ (1fe3 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804862Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2804929Protein Brain fatty acid binding protein [63809] (1 species)
  7. 2804930Species Human (Homo sapiens) [TaxId:9606] [63810] (3 PDB entries)
  8. 2804933Domain d1fe3a_: 1fe3 A: [59780]
    complexed with oleic acid
    complexed with ola

Details for d1fe3a_

PDB Entry: 1fe3 (more details), 2.8 Å

PDB Description: crystal structure of human brain fatty acid binding protein oleic acid
PDB Compounds: (A:) fatty acid-binding protein, brain

SCOPe Domain Sequences for d1fe3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fe3a_ b.60.1.2 (A:) Brain fatty acid binding protein {Human (Homo sapiens) [TaxId: 9606]}
veafcatwkltnsqnfdeymkalgvgfatrqvgnvtkptviisqegdkvvirtlstfknt
eisfqlgeefdettaddrncksvvsldgdklvhiqkwdgketnfvreikdgkmvmtltfg
dvvavrhyeka

SCOPe Domain Coordinates for d1fe3a_:

Click to download the PDB-style file with coordinates for d1fe3a_.
(The format of our PDB-style files is described here.)

Timeline for d1fe3a_: