Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
Protein Brain fatty acid binding protein [63809] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63810] (3 PDB entries) |
Domain d1fe3a_: 1fe3 A: [59780] complexed with oleic acid complexed with ola |
PDB Entry: 1fe3 (more details), 2.8 Å
SCOPe Domain Sequences for d1fe3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fe3a_ b.60.1.2 (A:) Brain fatty acid binding protein {Human (Homo sapiens) [TaxId: 9606]} veafcatwkltnsqnfdeymkalgvgfatrqvgnvtkptviisqegdkvvirtlstfknt eisfqlgeefdettaddrncksvvsldgdklvhiqkwdgketnfvreikdgkmvmtltfg dvvavrhyeka
Timeline for d1fe3a_: