SCOP 1.57: Domain d1fc5b2: 1fc5 B:6-177

Lineage for d1fc5b2 (1fc5 B:6-177)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.103: Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63881] (1 superfamily)

4. Superfamily b.103.1: Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63882] (1 family)

5. Family b.103.1.1: Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63883] (1 protein)

6. Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (1 species)

7. Species Escherichia coli [TaxId:562] [63885] (3 PDB entries)

8. Domain d1fc5b2: 1fc5 B:6-177 [59766]
   Other proteins in same PDB: d1fc5a1, d1fc5a3, d1fc5b1, d1fc5b3

Details for d1fc5b2

PDB Entry: 1fc5, 2.2 Å

PDB Description: crystal structure of molybdopterin biosynthesis moea protein

SCOP Domain Sequences for d1fc5b2:

Sequence; same for both SEQRES and ATOM records:

>d1fc5b2 b.103.1.1 (B:6-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli}
glmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrl
adiasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvr
ftaevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirk

Timeline for d1fc5b2:

• d1fc5b2 is new in SCOP 1.57
  
• d1fc5b2 appears in SCOP 1.59
  
• d1fc5b2 appears in the current release, SCOPe 2.08