Lineage for d1fc5a2 (1fc5 A:5-177)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 64274Fold b.103: Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63881] (1 superfamily)
  4. 64275Superfamily b.103.1: Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63882] (1 family) (S)
  5. 64276Family b.103.1.1: Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63883] (1 protein)
  6. 64277Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (1 species)
  7. 64278Species Escherichia coli [TaxId:562] [63885] (3 PDB entries)
  8. 64281Domain d1fc5a2: 1fc5 A:5-177 [59763]
    Other proteins in same PDB: d1fc5a1, d1fc5a3, d1fc5b1, d1fc5b3

Details for d1fc5a2

PDB Entry: 1fc5 (more details), 2.2 Å

PDB Description: crystal structure of molybdopterin biosynthesis moea protein

SCOP Domain Sequences for d1fc5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fc5a2 b.103.1.1 (A:5-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli}
tglmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavr
ladiasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngv
rftaevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirk

SCOP Domain Coordinates for d1fc5a2:

Click to download the PDB-style file with coordinates for d1fc5a2.
(The format of our PDB-style files is described here.)

Timeline for d1fc5a2: