SCOP 1.57: Domain d1fc5a3: 1fc5 A:178-236

Lineage for d1fc5a3 (1fc5 A:178-236)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families)

5. Family c.57.1.2: MoeA, central domain [64103] (1 protein)

6. Protein MoeA, central domain [64104] (1 species)

7. Species Escherichia coli [TaxId:562] [64105] (3 PDB entries)

8. Domain d1fc5a3: 1fc5 A:178-236 [59764]
   Other proteins in same PDB: d1fc5a1, d1fc5a2, d1fc5b1, d1fc5b2

Details for d1fc5a3

PDB Entry: 1fc5, 2.2 Å

PDB Description: crystal structure of molybdopterin biosynthesis moea protein

SCOP Domain Sequences for d1fc5a3:

Sequence; same for both SEQRES and ATOM records:

>d1fc5a3 c.57.1.2 (A:178-236) MoeA, central domain {Escherichia coli}
vrvalfstgdelqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraa

Timeline for d1fc5a3:

• d1fc5a3 is new in SCOP 1.57
  
• d1fc5a3 appears in SCOP 1.59
  
• d1fc5a3 appears in the current release, SCOPe 2.08