SCOP 1.57: Domain d1fc5a1: 1fc5 A:237-408

Lineage for d1fc5a1 (1fc5 A:237-408)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.85: beta-clip [51268] (6 superfamilies)

4. Superfamily b.85.6: Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63867] (1 family)

5. Family b.85.6.1: Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63868] (1 protein)

6. Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (1 species)

7. Species Escherichia coli [TaxId:562] [63870] (3 PDB entries)

8. Domain d1fc5a1: 1fc5 A:237-408 [59762]
   Other proteins in same PDB: d1fc5a2, d1fc5a3, d1fc5b2, d1fc5b3

Details for d1fc5a1

PDB Entry: 1fc5, 2.2 Å

PDB Description: crystal structure of molybdopterin biosynthesis moea protein

SCOP Domain Sequences for d1fc5a1:

Sequence; same for both SEQRES and ATOM records:

>d1fc5a1 b.85.6.1 (A:237-408) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Escherichia coli}
fieadsqadvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcg
lpgnpvsatltfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqrgvlqrn
adgelevtttghqgshifssfslgncfivlerdrgnvevgewvevepfnalf

Timeline for d1fc5a1:

• d1fc5a1 is new in SCOP 1.57
  
• d1fc5a1 appears in SCOP 1.59
  
• d1fc5a1 appears in the current release, SCOPe 2.08