Lineage for d1f99k_ (1f99 K:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2688849Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2688874Protein Phycocyanin alpha subunit [88933] (10 species)
  7. 2688887Species Red alga (Polysiphonia urceolata) [TaxId:65404] [88936] (1 PDB entry)
  8. 2688889Domain d1f99k_: 1f99 K: [59724]
    Other proteins in same PDB: d1f99b_, d1f99l_, d1f99n_
    complexed with bla, cyc, peb

Details for d1f99k_

PDB Entry: 1f99 (more details), 2.4 Å

PDB Description: crystal structure of r-phycocyanin from polysiphonia at 2.4 a resolution
PDB Compounds: (K:) r-phycocyanin

SCOPe Domain Sequences for d1f99k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f99k_ a.1.1.3 (K:) Phycocyanin alpha subunit {Red alga (Polysiphonia urceolata) [TaxId: 65404]}
mktplteaiaaadsqgrflsntelqvvngrynratssleaakaltanadrlisgaanavy
skfpyttqmpgpnysstaigkakcardigyylrmvtyclvvggtgpmddylvagleeinr
tfelspswyiealkyiknnhglsgdvaneantyidyaintls

SCOPe Domain Coordinates for d1f99k_:

Click to download the PDB-style file with coordinates for d1f99k_.
(The format of our PDB-style files is described here.)

Timeline for d1f99k_: