Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
Protein Phycocyanin beta subunit [88940] (9 species) |
Species Red alga (Polysiphonia urceolata) [TaxId:65404] [88942] (1 PDB entry) |
Domain d1f99b_: 1f99 B: [59723] Other proteins in same PDB: d1f99a_, d1f99k_, d1f99m_ complexed with bla, cyc, peb |
PDB Entry: 1f99 (more details), 2.4 Å
SCOPe Domain Sequences for d1f99b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f99b_ a.1.1.3 (B:) Phycocyanin beta subunit {Red alga (Polysiphonia urceolata) [TaxId: 65404]} mldafakvvaqadargeflsntqidallaivsegnkrldvvnkitnnasaivtnaaralf aeqpqlispggnaytsrrmaaclrdmeivlryvsyamiagdasvlddrclnglretyqal gtpgasvavaiqkmkdaalalvndttgtpagdcaslvaeiatyfdraaaava
Timeline for d1f99b_: