![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily) beta-alpha(3)-beta(2) motif |
![]() | Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) ![]() possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1) |
![]() | Family d.150.1.2: Holo-(acyl carrier protein) synthase ACPS [64418] (1 protein) forms trimers with three closely packed beta-sheets similar to the IspF trimers automatically mapped to Pfam PF01648 |
![]() | Protein Holo-(acyl carrier protein) synthase ACPS [64419] (2 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [64420] (3 PDB entries) |
![]() | Domain d1f7tc1: 1f7t C:2-119 [59669] Other proteins in same PDB: d1f7ta2, d1f7tb2, d1f7tc2, d1f7td2, d1f7te2, d1f7tf2 complexed with cl, dtt, gol, na |
PDB Entry: 1f7t (more details), 1.8 Å
SCOPe Domain Sequences for d1f7tc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f7tc1 d.150.1.2 (C:2-119) Holo-(acyl carrier protein) synthase ACPS {Bacillus subtilis [TaxId: 1423]} iygiglditelkriasmagrqkrfaeriltrseldqyyelsekrkneflagrfaakeafs kafgtgigrqlsfqdieirkdqngkpyiictklspaavhvsithtkeyaaaqvvierl
Timeline for d1f7tc1: