SCOP 1.57: Domain d1f7tc_: 1f7t C:

Lineage for d1f7tc_ (1f7t C:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)

4. Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (2 families)

5. Family d.150.1.2: Holo-(acyl carrier protein) synthase ACPS [64418] (1 protein)

6. Protein Holo-(acyl carrier protein) synthase ACPS [64419] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [64420] (3 PDB entries)

8. Domain d1f7tc_: 1f7t C: [59669]

Details for d1f7tc_

PDB Entry: 1f7t, 1.8 Å

PDB Description: holo-(acyl carrier protein) synthase at 1.8a

SCOP Domain Sequences for d1f7tc_:

Sequence; same for both SEQRES and ATOM records:

>d1f7tc_ d.150.1.2 (C:) Holo-(acyl carrier protein) synthase ACPS {Bacillus subtilis}
giygiglditelkriasmagrqkrfaeriltrseldqyyelsekrkneflagrfaakeaf
skafgtgigrqlsfqdieirkdqngkpyiictklspaavhvsithtkeyaaaqvvierl

Timeline for d1f7tc_:

• d1f7tc_ is new in SCOP 1.57
  
• d1f7tc_ appears in SCOP 1.59
  
• d1f7tc_ appears in the current release, SCOPe 2.08, called d1f7tc1