Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily) beta-alpha(3)-beta(2) motif |
Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1) |
Family d.150.1.2: Holo-(acyl carrier protein) synthase ACPS [64418] (1 protein) forms trimers with three closely packed beta-sheets similar to the IspF trimers automatically mapped to Pfam PF01648 |
Protein Holo-(acyl carrier protein) synthase ACPS [64419] (2 species) |
Species Bacillus subtilis [TaxId:1423] [64420] (3 PDB entries) |
Domain d1f7tc_: 1f7t C: [59669] complexed with cl, dtt, gol, na |
PDB Entry: 1f7t (more details), 1.8 Å
SCOPe Domain Sequences for d1f7tc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f7tc_ d.150.1.2 (C:) Holo-(acyl carrier protein) synthase ACPS {Bacillus subtilis [TaxId: 1423]} giygiglditelkriasmagrqkrfaeriltrseldqyyelsekrkneflagrfaakeaf skafgtgigrqlsfqdieirkdqngkpyiictklspaavhvsithtkeyaaaqvvierl
Timeline for d1f7tc_: