SCOPe 2.05: Domain d1f7te_: 1f7t E:

Lineage for d1f7te_ (1f7t E:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
   beta-alpha(3)-beta(2) motif

4. Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families)
   possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)

5. Family d.150.1.2: Holo-(acyl carrier protein) synthase ACPS [64418] (1 protein)
   forms trimers with three closely packed beta-sheets similar to the IspF trimers
   automatically mapped to Pfam PF01648

6. Protein Holo-(acyl carrier protein) synthase ACPS [64419] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [64420] (3 PDB entries)

8. Domain d1f7te_: 1f7t E: [59671]
   complexed with cl, dtt, gol, na

Details for d1f7te_

PDB Entry: 1f7t, 1.8 Å

PDB Description: holo-(acyl carrier protein) synthase at 1.8a

PDB Compounds: (E:) holo-(acyl carrier protein) synthase

SCOPe Domain Sequences for d1f7te_:

Sequence; same for both SEQRES and ATOM records:

>d1f7te_ d.150.1.2 (E:) Holo-(acyl carrier protein) synthase ACPS {Bacillus subtilis [TaxId: 1423]}
giygiglditelkriasmagrqkrfaeriltrseldqyyelsekrkneflagrfaakeaf
skafgtgigrqlsfqdieirkdqngkpyiictklspaavhvsithtkeyaaaqvvier

Timeline for d1f7te_:

• d1f7te_ first appeared in SCOP 1.57
  
• d1f7te_ appears in SCOPe 2.04
  
• d1f7te_ is called d1f7te1 in SCOPe 2.06
  
• d1f7te_ appears in the current release, SCOPe 2.08, called d1f7te1